PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr8g073050.1
Common NameMTR_8g073050
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 226aa    MW: 24791 Da    PI: 9.6838
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr8g073050.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.49.1e-10104144343
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksr 43 
                      +W++ E++l++ +  ++G+g W++Ia+     +t+ q+ks+
  Medtr8g073050.1 104 SWSQLEHDLFLMGLIEYGKGKWSKIAKNYVSSKTRQQVKSY 144
                      7*****************************999******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129310.435100153IPR017884SANT domain
SMARTSM007176.0E-6101151IPR001005SANT/Myb domain
SuperFamilySSF466894.45E-8104149IPR009057Homeodomain-like
CDDcd001676.14E-8104144No hitNo description
PfamPF002497.7E-8104144IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-8104144IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MPIEIIDLTS SPDSPPSTPV SLSNLPTILN FAPVSTNPNL HHQIHPHQHQ TTLFVPPPPG  60
FETPQIATGW PQPGMYHSQI AMVLKPLPEP KTSQFSNGAR LGVSWSQLEH DLFLMGLIEY  120
GKGKWSKIAK NYVSSKTRQQ VKSYGLSFFM YLPATFVHGF RKRKQIANPS NSASKRNRNS  180
PSAPYYGEEA SSSNTNNYEA ITSMTLPSAS DDGGVDLELR LGLSK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1743790.0AC174379.16 Medicago truncatula chromosome 8 clone mth2-57p18, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003629092.11e-166MYB-like DNA-binding domain protein
TrEMBLG7L8N41e-166G7L8N4_MEDTR; MYB-like DNA-binding domain protein
STRINGGLYMA06G14875.17e-38(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14942612
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.12e-13MYB family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]